DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32099 and LYS5

DIOPT Version :9

Sequence 1:NP_729788.1 Gene:CG32099 / 317852 FlyBaseID:FBgn0052099 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_011361.1 Gene:LYS5 / 852723 SGDID:S000003122 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:56/225 - (24%)
Similarity:83/225 - (36%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TLPQLSQAVASIQPEERARLMKFHFIDDFLSSLIGRLFMRKYVSTCSGLPSAEVKFARDVRGKPY 83
            |||..||          ||::......|..|:|..:|......|..:||...|:||.:...|||:
Yeast    45 TLPLASQ----------ARILNKKSFHDRCSNLCSQLLQLFGCSIVTGLNFQELKFDKGSFGKPF 99

  Fly    84 WVKGEDYDGPPLSFNVSHQGSLVLLAGIAGESSDPDFGIGTDVMK-IEYNGGKPLS--------- 138
            .   ::....|.|..:..|...:.|  :...|:|....:|.|:.. ..|.|.:.|.         
Yeast   100 L---DNNRFLPFSMTIGEQYVAMFL--VKCVSTDEYQDVGIDIASPCNYGGREELELFKEVFSER 159

  Fly   139 EFFGLMKSKFSAEEWSYIGRPHHDEREQVKAFMRHWCLKEAYVKELGVGITVDLQKISFSV---- 199
            ||.||:|:......::|:                 |.|||:|.|..|.|:..||..|.|..    
Yeast   160 EFNGLLKASDPCTIFTYL-----------------WSLKESYTKFTGTGLNTDLSLIDFGAISFF 207

  Fly   200 ---DTTRSLETDVSPLIGTSLRCHDQPMDN 226
               ..:..:..|..|||     .|.|..:|
Yeast   208 PAEGASMCITLDEVPLI-----FHSQWFNN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32099NP_729788.1 Sfp 6..>197 CDD:225002 48/187 (26%)
ACPS 121..243 CDD:279918 30/123 (24%)
LYS5NP_011361.1 Sfp 19..255 CDD:225002 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I1875
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002791
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102195
Panther 1 1.100 - - LDO PTHR12215
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.