DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32099 and lys7

DIOPT Version :9

Sequence 1:NP_729788.1 Gene:CG32099 / 317852 FlyBaseID:FBgn0052099 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_594603.1 Gene:lys7 / 2542118 PomBaseID:SPAC17C9.02c Length:258 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:71/267 - (26%)
Similarity:104/267 - (38%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WAFDLGSWRPTLPQLSQAVASIQPEERARLMKFHFIDDFLSSLIGRLFMRKYVSTCSGLPSAEVK 73
            |.|:    |..:|...:    :...||.::.:::|..|...:|...|..|..|||.......||:
pombe    16 WPFE----RTRIPSFKK----LSDSERQQIERYYFDMDAKMALASILIKRHLVSTALECSPNEVQ 72

  Fly    74 FARDVRGKPYWVKGEDYDGPPL--SFNVSHQGSLVLLAGIAGESSDPD----FGIGTDVMKIEYN 132
            .:....|:||.   :....||:  .|||||.|.:|::.| |...|||.    ..||.|:::.   
pombe    73 ISVTKAGRPYC---QSAHCPPIIFDFNVSHYGGIVIVVG-AWLPSDPSGMRPINIGVDIVEC--- 130

  Fly   133 GGKPLSEFFGLMK---SKFSAEEWSYIGRPHHDEREQVKAFMRHWCLKEAYVKELGVG------- 187
              |||:.....|:   |.|:..||..|    ......:..|...|..|||.:|.||:|       
pombe   131 --KPLAFEASWMEDFMSVFTPCEWKLI----KSSISSIDVFFLLWTCKEAILKALGIGLSGNPLD 189

  Fly   188 ITVDLQKI-----SFSVDTTRSLETDVSPLIGTSLRCHDQPMDNWHFEEHLL---QEDYCAAIAF 244
            |.|...|:     |..|...|:.....|   |.|          |..|.|.|   ...:..::||
pombe   190 IVVTFHKLNELLNSEEVSLRRAATAVYS---GYS----------WDLEIHKLILHSSTFYVSVAF 241

  Fly   245 RNCLPQE 251
                ||:
pombe   242 ----PQD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32099NP_729788.1 Sfp 6..>197 CDD:225002 57/208 (27%)
ACPS 121..243 CDD:279918 34/139 (24%)
lys7NP_594603.1 Sfp 3..243 CDD:225002 69/264 (26%)
ACPS 122..>214 CDD:294340 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2019
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002791
OrthoInspector 1 1.000 - - oto100897
orthoMCL 1 0.900 - - OOG6_102195
Panther 1 1.100 - - LDO PTHR12215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R675
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.