DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32099 and aasdhppt

DIOPT Version :9

Sequence 1:NP_729788.1 Gene:CG32099 / 317852 FlyBaseID:FBgn0052099 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001120584.1 Gene:aasdhppt / 100145738 XenbaseID:XB-GENE-985885 Length:308 Species:Xenopus tropicalis


Alignment Length:287 Identity:90/287 - (31%)
Similarity:139/287 - (48%) Gaps:23/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RWAFDLGSWRPTLPQLSQAVASIQPEERARLMKFHFIDDFLSSLIGRLFMRKYVSTCSGLPSAEV 72
            ||||...||.|:..:.......:||||:.|:.:|.|..|..:::.|||.|||.::....:|..::
 Frog    15 RWAFHCSSWAPSQAEWLLCARCVQPEEKERIGQFMFTRDAKAAMAGRLLMRKVIAEKLQIPWDKI 79

  Fly    73 KFARDVRGKPYWVKGEDYDGPPLSFNVSHQGSLVLLAGIAGESSDPDFGIGTDVMKIEYNGGKPL 137
            ...|..:|||:...|...:.|...|||||||...:||      ::|...:|.|:||.:..|...:
 Frog    80 LLQRTEKGKPFLCYGSSSEYPLFKFNVSHQGDYAVLA------AEPYRQVGVDIMKTDLPGSGSI 138

  Fly   138 SEFFGLMKSKFSAEEWSYIGRPHHDEREQVKAFMRHWCLKEAYVKELGVGITVDLQKISFSVDTT 202
            .|||.||..:|:.:||..| |..:.:..|:..|.|||.|||:::|.:|||:..:||.|.|.|.  
 Frog   139 KEFFRLMDRQFTEKEWHSI-RSMNSDWAQLDMFYRHWALKESFIKAIGVGLGFNLQLIEFEVS-- 200

  Fly   203 RSLETDVSPLIGTSLRCHDQPMDNWHFEEHLLQEDYCAAIAF---RNCLPQE-------RGKFKF 257
             .:..|:......:....|...:.|.|||.||...:..|:|.   ...|.|.       ...|:.
 Frog   201 -PVNMDIGKTYKQTKMFLDDEEETWAFEEILLDNQHHVAVALGEVDQLLHQSHKINDVTESTFEL 264

  Fly   258 LQVEELL---VKSEDSELEEVISYCQK 281
            |..|:|:   |...|.:.:..|::..|
 Frog   265 LSFEDLMASAVPMSDEDPDYWINFQSK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32099NP_729788.1 Sfp 6..>197 CDD:225002 68/188 (36%)
ACPS 121..243 CDD:279918 41/121 (34%)
aasdhpptNP_001120584.1 ACPS 122..240 CDD:279918 41/121 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8643
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9130
Inparanoid 1 1.050 144 1.000 Inparanoid score I4351
OMA 1 1.010 - - QHG55385
OrthoDB 1 1.010 - - D618598at33208
OrthoFinder 1 1.000 - - FOG0002791
OrthoInspector 1 1.000 - - oto103107
Panther 1 1.100 - - LDO PTHR12215
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4854
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.