DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and AT5G41980

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_199013.1 Gene:AT5G41980 / 834203 AraportID:AT5G41980 Length:374 Species:Arabidopsis thaliana


Alignment Length:385 Identity:73/385 - (18%)
Similarity:116/385 - (30%) Gaps:102/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DEEPHDKIGVPCTFPSF---DSHFFEHVIPELSEEDFLNTLHVTRGTFETLCKQLSPTLRTSDEL 135
            :|:..:.:.:|......   |.:.|.:.|.....|.......:.:..|..||..|.     :..|
plant     6 EEDKEEAVTLPKEVSKISISDGNKFVYQILNGPNEQCFENFRMDKPVFYKLCDLLQ-----TRGL 65

  Fly   136 TQREPAISTEKCVALALNFLASGERLSLIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQLPQN 200
            .:....|..|..:|:.|..:....|...:.|.|........:......|||:             
plant    66 LRHTNRIKIEAQLAIFLFIIGHNLRTRAVQELFCYSGETISRHFNNVLNAVI------------- 117

  Fly   201 PVDCNSVAKG-FQRESNMPAA---------LVGVLGVCSIPI------------------RSTGE 237
                 :::|. ||..||....         .|||:....||:                  ::...
plant   118 -----AISKDFFQPNSNSDTLENDDPYFKDCVGVVDSFHIPVMVGVDEQGPFRNGNGLLTQNVLA 177

  Fly   238 AKNSILRMEYLL--------DDRMLFRELQLGCGLRATLGPMFSHAPNTLTAIPEFRINSRLVPA 294
            |.:..||..|:|        |.::|...|.                          |.|...||.
plant   178 ASSFDLRFNYVLAGWEGSASDQQVLNAALT--------------------------RRNKLQVPQ 216

  Fly   295 FVLAPVYQNYPLRPWLLQRYTDPTAPHEHDFNEVAEHLQELSDCALHR----LMSRWSFLSQPLD 355
            .....|...||..|..:..|...:.....:..|:.....:|...|:||    |..|:..|.....
plant   217 GKYYIVDNKYPNLPGFIAPYHGVSTNSREEAKEMFNERHKLLHRAIHRTFGALKERFPILLSAPP 281

  Fly   356 ISFHTASCIITAAAVLHNLLEELSEPHMLEWGNSVDVSKFRAEPLSDSVSEDAESHAALE 415
            ....|...::.||..|||.:.       ||..:.:....|..|.|::: .||.|  .|||
plant   282 YPLQTQVKLVIAACALHNYVR-------LEKPDDLVFRMFEEETLAEA-GEDRE--VALE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 10/57 (18%)
DDE_Tnp_4 <304..373 CDD:304434 16/72 (22%)
AT5G41980NP_199013.1 DDE_Tnp_4 147..299 CDD:419734 31/177 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.