DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and AT5G35695

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_680341.1 Gene:AT5G35695 / 833543 AraportID:AT5G35695 Length:211 Species:Arabidopsis thaliana


Alignment Length:168 Identity:41/168 - (24%)
Similarity:56/168 - (33%) Gaps:51/168 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 GEAKNS-----ILRMEYLLDDRMLFRELQLGCGLRATLGPMFSHAPNTLTAIPEFRINSRLVPAF 295
            |.|.:|     .||..||:|           ||.           .|.|..:..||         
plant    34 GSAHDSRVLSDALRKFYLVD-----------CGF-----------ANRLNFLAPFR--------- 67

  Fly   296 VLAPVYQNYPLRPWLLQRYTDPTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHT 360
                 ...|.|:.:..|| .||..|||. ||.....|:.:.:.......||::........|:..
plant    68 -----GVRYHLQEFAGQR-RDPETPHEL-FNLRHVSLRNVIERIFGIFKSRFAIFKSAPPFSYKK 125

  Fly   361 ASCIITAAAVLHNLL------EELSEPHMLEWGNSVDV 392
            .:.::...|.|||.|      :|...|.  |.||..||
plant   126 QAGLVLTCAALHNFLRKECRSDEADFPD--EVGNEGDV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715
DDE_Tnp_4 <304..373 CDD:304434 17/68 (25%)
AT5G35695NP_680341.1 DDE_Tnp_4 <25..138 CDD:304434 31/141 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.