DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and AT5G28730

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_198225.1 Gene:AT5G28730 / 832985 AraportID:AT5G28730 Length:296 Species:Arabidopsis thaliana


Alignment Length:300 Identity:56/300 - (18%)
Similarity:108/300 - (36%) Gaps:78/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EEDFLNTLHVTRGTFETLCKQLSPTLRTSDEL------TQREPAISTEKCVALALNFLASGERLS 162
            ||...:.::....:.:||.:..|.......|:      .|....||.::.||:.|...||.:...
plant    10 EECIAHQIYSNEVSCQTLIRMSSEAFTQLCEILHGKYGLQSSTNISLDESVAIFLIICASNDTQR 74

  Fly   163 LIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQL------PQNPVDCNSVAKGFQRESNMPAAL 221
            .||.||...: .||  .:.|.:.:     :|:.:|      |:...:..:::...|.::.....|
plant    75 DIALRFGHAQ-ETI--WRKFHDVL-----KAMERLAVEYIRPRKVEELRAISNRLQDDTRYWPFL 131

  Fly   222 VGVLGVCSIPIRSTGEAKNSILRMEYLLDDRMLFRELQLGCG--------LRATLG--PMFSHAP 276
            :.:||:.|..:.:             :.|..|||....:|..        |.|.:.  |:| |.|
plant   132 MDLLGIASFNVLA-------------ICDLDMLFTYCFVGMAGSTHDARVLSAAISDDPLF-HVP 182

  Fly   277 -------------NTLTAIPEFRINSR-----LVPAFVLAPVYQNYPLRPWLLQRYTDPT----A 319
                         |....:..:|...|     :...|:...:::.:.::.:.........    |
plant   183 PDSKYYLVDSGYANKRGYLAPYRREHREAQDIISNNFLTVNLFETHNIKDYDFDNVDSENNVVQA 247

  Fly   320 PH----EHDFNEVAEHLQELSDCALHRLMSR-------WS 348
            ||    |.|.|:..| ::|.|:..::..:.|       ||
plant   248 PHDATDEQDNNDGIE-IEESSEAEMYMRIVRDQIAEHIWS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 5/24 (21%)
DDE_Tnp_4 <304..373 CDD:304434 11/59 (19%)
AT5G28730NP_198225.1 DDE_Tnp_4 139..>212 CDD:304434 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.