DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and AT4G10890

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001319897.1 Gene:AT4G10890 / 826688 AraportID:AT4G10890 Length:527 Species:Arabidopsis thaliana


Alignment Length:124 Identity:36/124 - (29%)
Similarity:44/124 - (35%) Gaps:23/124 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MLRTFFMRQMMEMHSNYLHTYAMLRLKHSQVVDTESETSDVDEEP--HDKIGVPCTFPSFDSHFF 95
            |:|.|..|:        ||.|..| ...|....|.| ...||:|.  |..|..|||..|......
plant   375 MIRVFKKRE--------LHKYGAL-TPDSTTKGTVS-LGSVDKESNNHPLINSPCTGRSVVDSRL 429

  Fly    96 EH------VIPELSEEDFLNTLHV--TRGTFETLCKQLSPTLRTSDELTQREPAISTEK 146
            |:      |.|.....|....|.:  .|...|| |.  ...::||..||:..|...|.|
plant   430 ENCKLSKDVPPPKPLRDVNQILSILQKRNATET-CS--DNNMQTSVLLTKVPPESETSK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 20/72 (28%)
DDE_Tnp_4 <304..373 CDD:304434
AT4G10890NP_001319897.1 DDE_Tnp_4 <72..161 CDD:304434
DUF2439 245..314 CDD:287368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.