DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and si:ch73-257c13.2

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_005160827.1 Gene:si:ch73-257c13.2 / 566826 ZFINID:ZDB-GENE-081104-269 Length:397 Species:Danio rerio


Alignment Length:412 Identity:80/412 - (19%)
Similarity:134/412 - (32%) Gaps:101/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLRRRTQQRTRRRFRMLRTFFMRQMMEMHSNYLHTYAMLRLKHSQVVDTESETSDVDEEPHDKI 81
            ::|..:...|.|||                      .:.::||:.:.|....:..|.|    .|:
Zfish    20 IMLFNKNATRKRRR----------------------ASSVKLKNEESVQVNLKREDDD----GKV 58

  Fly    82 GVPCTFPSFDSHFFEHVIPELSEEDFLNTLHVTRGTFETLCKQLSP----TLRTSDELTQREPAI 142
                        .|..|:..|:..||.:...:|....|.|.:.|:|    .:|..|        .
Zfish    59 ------------VFNAVLQSLTISDFKSHFQLTPTQTEELVQLLAPCKWAAIRQED--------W 103

  Fly   143 STEKCVALALNFLASGERLSLIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQLPQNPVDCNSV 207
            :....|..:|..|::.|....:|.||.:........:..||..|.:.|...: ..|| ..:.:..
Zfish   104 TVWHAVLSSLWTLSTQESYQSVANRFHVAESLICDQMDEFCTLVTTNLANHI-HWPQ-AEEADMC 166

  Fly   208 AKGFQRESNMPAALVGVLGVCSIPIRSTGEAKNSILRMEYLLDDRMLFRELQLGCGLRATLGPMF 272
            .|||.....:|..|. |:|...|||....:..:|.:   |...:...|.:|...|          
Zfish   167 VKGFFSAVGLPDTLC-VVGTRLIPIMKPTDVPDSEV---YRDTEGAYFAKLMAFC---------- 217

  Fly   273 SHAPNTLTAIPEFRI---NSRLVPAFVLAPVYQNYPLR----PWLLQRYTDPTAPH--------- 321
            .|.........|..|   |||::.|..:....|..|:.    ..:|...|.|...|         
Zfish   218 DHKGRFTYVSAEHPINWHNSRVLSATEVGKALQEDPVALLHGKHILGDSTFPLTEHVLTPFPDYG 282

  Fly   322 -----EHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASCIITAAAVLHNLLEEL--- 378
                 :..:|:.......:...::|.|.|.:..|......|....|..:.|..:|:|:..|.   
Zfish   283 TFGQKKVCYNQKVRSALAVVQGSIHTLRSCFQRLGCLQKHSVCQTSLSVKACCILYNMYLETYNV 347

  Fly   379 ----------SEP-HMLEWGNS 389
                      .:| |.|.:|:|
Zfish   348 IVDCMDDDIPQKPFHELPYGHS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 13/66 (20%)
DDE_Tnp_4 <304..373 CDD:304434 14/86 (16%)
si:ch73-257c13.2XP_005160827.1 DDE_Tnp_4 187..339 CDD:304434 30/164 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D538878at33208
OrthoFinder 1 1.000 - - FOG0000380
OrthoInspector 1 1.000 - - otm26405
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.