DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and CG12253

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_652056.2 Gene:CG12253 / 47730 FlyBaseID:FBgn0026148 Length:378 Species:Drosophila melanogaster


Alignment Length:345 Identity:72/345 - (20%)
Similarity:135/345 - (39%) Gaps:87/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IPELSEEDFLNTLHVTRGTFETLCKQLSPTLRTSDELTQREPAISTEKCVALALNFLAS------ 157
            :.:|:|..|......|:   |.| :::...:|...|:...|| :..|: |.:.|..|::      
  Fly    47 LTDLNEHKFRLKYRYTK---ENL-RRIIEIVRDDLEIEYFEP-LKREQ-VPIDLQILSAIRLWGG 105

  Fly   158 --GERLSLIAERFSLPRPRTI-KCLKVFCNAVMSTLGRALRQLPQNPVDCNSVAKGFQRESNMPA 219
              ..:|:.:|...||   ||: |..:...:.:.|...|.:| :|....:.......||..:|||.
  Fly   106 TEHPKLTAMAHGVSL---RTLAKITRRVASVLSSKASRYIR-MPATLSEKERSGSAFQAIANMPQ 166

  Fly   220 ALVGVLGV--------CS------------------IPIRSTGEAKNSILRMEY-LLDDRMLFRE 257
            .:..:|..        |:                  :.|:...:|.:.|..::. |:|::.:..:
  Fly   167 VIGALLQTTVRFQPENCAPDLDGEELLPALTSREEELHIQIVCDAAHKIRDLDIRLIDEQSMLTD 231

  Fly   258 LQLGCGLRATLGPMFSHAPNTLTAIPEFR----INSRLV--PAFVLAPVYQNYPLRPWLLQRYTD 316
            .:: .|| :.:...|..        .|||    :.:.:|  .:.:..||  .:|      :..::
  Fly   232 TEM-FGL-SKIKDRFEQ--------NEFRGRILLGNEMVRCSSSLFTPV--RFP------RNQSE 278

  Fly   317 PTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASCIITAAAVLHNLLEELSEP 381
            ....|.|     |........| |:.||||:..|:..:..|..:|...|||.|:|||:..|..:|
  Fly   279 ELYNHAH-----AVTYASARKC-LNLLMSRFGILATEIQGSHGSAKQTITALAILHNMAMEWVDP 337

  Fly   382 HMLEWGNSVD----VSKFRA 397
                   |:|    :|.|.:
  Fly   338 -------SIDTEQNISPFNS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 6/29 (21%)
DDE_Tnp_4 <304..373 CDD:304434 18/68 (26%)
CG12253NP_652056.2 DDE_Tnp_4 203..329 CDD:304434 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47131
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.