DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and Harbi1

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001343447.1 Gene:Harbi1 / 241547 MGIID:2443194 Length:349 Species:Mus musculus


Alignment Length:281 Identity:66/281 - (23%)
Similarity:105/281 - (37%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TQREPAISTEKCVALALNFLASGERLSLIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQLPQN 200
            |||..|||.|..:..||.|..||...:.:.:...:.:....:|:   .|...:.:.|| .|....
Mouse    61 TQRSRAISPETQILAALGFYTSGSFQTRMGDAIGISQASMSRCV---ANVTEALVERA-SQFIHF 121

  Fly   201 PVD---CNSVAKGFQRESNMPAALVGVLGVCS---IPIRSTGEAKNSILRMEYLLDDRMLFRELQ 259
            |||   ..|:...|...:.||    ||:||..   :.|::......|.:..:.|.....|     
Mouse   122 PVDEAAVQSLKDEFYGLAGMP----GVIGVADCIHVAIKAPNAEDLSYVNRKGLHSLNCL----- 177

  Fly   260 LGCGLRATLGPMFSHAPNTL----------------TAIPEFRINSRLVPAFVLAPVYQNYPLRP 308
            :.|.:|..|..:.:..|.:|                |.:|:        .:::|..  .::.||.
Mouse   178 VVCDIRGALMTVETSWPGSLQDCAVLQRSSLTSQFETGMPK--------DSWLLGD--SSFFLRS 232

  Fly   309 WLLQRYTDPTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFL---SQPLDISFHTASCIITAAAV 370
            |||.....|....|:.:|........:.:..|..|..|:..|   ...|..|....|.||.|..|
Mouse   233 WLLTPLPIPETAAEYRYNRAHSATHSVIERTLQTLCCRFRCLDGSKGALQYSPEKCSHIILACCV 297

  Fly   371 LHNLLEELSEPHMLE-WGNSV 390
            |||    :|..|.:: |.:.|
Mouse   298 LHN----ISLDHGMDVWSSPV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715
DDE_Tnp_4 <304..373 CDD:304434 20/71 (28%)
Harbi1NP_001343447.1 DDE_Tnp_4 149..300 CDD:372577 32/165 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47131
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.