DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and CG43088

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001245670.1 Gene:CG43088 / 12797977 FlyBaseID:FBgn0262534 Length:362 Species:Drosophila melanogaster


Alignment Length:321 Identity:67/321 - (20%)
Similarity:115/321 - (35%) Gaps:102/321 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LSEEDFLNTLHVTRGTFETLCKQLSPTLRTSDELTQREPAISTEKCVALALNFLASG-------- 158
            :|::.|:....:.:.||:.:.|.:.|.::.|        |:|....:|....:|.:|        
  Fly    65 ISDQSFVKFYAIDKITFKKILKVVKPYVQVS--------ALSHPIQLAAVFRYLVTGCSELAVAH 121

  Fly   159 --------ERLSLIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQLPQNPVDCNSVAKGFQRES 215
                    ..|:.|..|| :|..:     |:.|.|.:|.      |:.:..:..:|  |.|..:.
  Fly   122 DYRVRIESSMLAKILNRF-IPLLQ-----KLLCQATISI------QMSRQQMQISS--KNFWEKY 172

  Fly   216 NMP---AALVGV-LGV------CSIPIRSTGEAKNSIL-----RMEYLLDD-------------- 251
            .:|   |.|||. :|:      ||..:...|....:::     .||.:..|              
  Fly   173 KLPKVVACLVGTHIGIKKPAKDCSDFLNKKGYYSLNVMLVCNDNMEIIASDATFPGSCRDSVIWN 237

  Fly   252 RMLFRELQLGCGLRATLGPMFSHAPNTLTAIPEFRINSRL-VPAFVLAPVYQNYPLRPWLLQRYT 315
            |...|||     |..||...|..|            ||:. ..:|||.| |:|..:         
  Fly   238 RSRAREL-----LSVTLNGHFILA------------NSKYSQESFVLTP-YKNAEI--------- 275

  Fly   316 DPTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASC--IITAAAVLHNL 374
               ..::|.||......:.:.:..:..|.:|  ||.....:.:..:.|  |:.....||||
  Fly   276 ---GTYQHTFNLRHAQARNMVEQTIEVLKNR--FLCLQRGLKYEPSFCCMIVNVCCALHNL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 6/26 (23%)
DDE_Tnp_4 <304..373 CDD:304434 10/70 (14%)
CG43088NP_001245670.1 DDE_Tnp_4 183..330 CDD:290096 35/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4585
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.