DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and LOC110439166

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_021329751.1 Gene:LOC110439166 / 110439166 -ID:- Length:207 Species:Danio rerio


Alignment Length:218 Identity:47/218 - (21%)
Similarity:73/218 - (33%) Gaps:62/218 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 PVDCNSVAKG--FQRESNMPAALVGVLGVCSIPIRSTGEAKNSILRMEY----LLDDRMLFRELQ 259
            |:...|:.:|  ..|:|..           ||.::...||...|..:|.    .:.|..:|||..
Zfish    22 PIKAPSINEGDYVNRKSTH-----------SINVQVICEATQIITNVEAKWPGSVHDARIFRESS 75

  Fly   260 LGCGLRATLGPMFSHAPNTLTAIPEFRINSRLVPAFVLAPVYQNYPLRPWLLQRYTDPTAPHEHD 324
            | |                 .|..:.:.|..|:..       :.||..|:|:..|.:|....:..
Zfish    76 L-C-----------------QAFQQGQYNGYLLGD-------RGYPCLPYLMTPYPEPEPGPQTR 115

  Fly   325 FNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASCIITAAAVLHNLLEELSEPHMLEWGNS 389
            .|......:...:..:..|.||:..| :.|.:|...|..||.|..||||                
Zfish   116 LNLAYSRTRAKVEMTIGILKSRFQCL-RGLRVSPERACDIIVACVVLHN---------------- 163

  Fly   390 VDVSKFRAEPLSDSVSEDA-ESH 411
              ::..|.|.|...:..|. |.|
Zfish   164 --IATIRGESLPPCIEGDGPEEH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715
DDE_Tnp_4 <304..373 CDD:304434 19/68 (28%)
LOC110439166XP_021329751.1 DDE_Tnp_4 16..163 CDD:315924 39/177 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.