DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and LOC108183316

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_017210663.2 Gene:LOC108183316 / 108183316 -ID:- Length:926 Species:Danio rerio


Alignment Length:230 Identity:53/230 - (23%)
Similarity:88/230 - (38%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 VAKGFQRESNMPAALVGVLGVCSIPIRSTGEAK--------NSILRMEYLLDDRMLFRELQLG-- 261
            :.:||:.....| .:.|.:....|.|::.....        |..:.::.::|::|.|.::.:|  
Zfish     2 IVQGFRDRWGFP-QVAGAIDGTHINIKAPSNTPADYYNRKGNYSIVLQAVVDNKMKFWDINVGQP 65

  Fly   262 ---------C-------GLRATLGPMFSHAPNTLTAIPEFRINSRLVPAFVLAPVYQNYPLRPWL 310
                     |       |...||.|.::   .|..||.        ||.|:|..  ..|||..||
Zfish    66 GKVHDARVFCLSSLFDGGSSGTLLPTWT---ETFEAID--------VPLFLLGD--SAYPLSHWL 117

  Fly   311 LQRYTD--PTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASCIITAAAVLHN 373
            ::.|.:  ...|.:..||......:...:.|..||..||..|.:..:......|.|::|..||||
Zfish   118 MKPYPEGRGVTPEQIKFNHRLSQARMTVERAFGRLKGRWRCLLKQCEAHITLVSRIVSACCVLHN 182

  Fly   374 LLEELSEPHMLEWGNSVDVSKFRAEPLSDSVSEDA 408
            ..|..:|    |:....||.:      .:..|:||
Zfish   183 FCEVRNE----EFYGRDDVRE------EEEQSQDA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715
DDE_Tnp_4 <304..373 CDD:304434 20/70 (29%)
LOC108183316XP_017210663.2 DDE_Tnp_4 19..182 CDD:315924 39/175 (22%)
FISNA 225..295 CDD:316956
NACHT 305..473 CDD:310381
LRR_RI <807..>914 CDD:330982
leucine-rich repeat 831..859 CDD:275378
leucine-rich repeat 860..880 CDD:275378
leucine-rich repeat 889..900 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D538878at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.