DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32095 and LOC103911715

DIOPT Version :9

Sequence 1:NP_729755.1 Gene:CG32095 / 317849 FlyBaseID:FBgn0052095 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_009303385.1 Gene:LOC103911715 / 103911715 -ID:- Length:408 Species:Danio rerio


Alignment Length:369 Identity:94/369 - (25%)
Similarity:154/369 - (41%) Gaps:60/369 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 FEHVIPELS--EEDFLNTLHVTRGTFETLCKQLSPTLRTSDELTQREPAISTEKCVALALNFLAS 157
            |..:|.||.  .:.|.....|:...||:|.|.::|:|..| ....|:| |:.|:.:|:.|.||.:
Zfish    44 FRRLIKELKLYHDRFHRYFRVSVSQFESLLKLVAPSLCKS-RTNFRKP-INPEQRLAVCLRFLGT 106

  Fly   158 GERLSLIAERFSLPRPRTIKCLKVFCNAVMSTLGRALRQLPQNPVDCNSVAKGFQRESNMPAALV 222
            |:....||...||......:.:...|:|:.|.|......:|...| ..|:||.||...::|..| 
Zfish   107 GDSYRTIASSLSLGISTVARVVAETCDAIWSCLKDEYMPVPTEDV-WRSIAKRFQERWSLPNCL- 169

  Fly   223 GVLGVCSIPIRSTGEAKNSILRMEY----------LLDDRMLFRELQLG-CGLRATLGPMFSH-- 274
            ||:....|.::|.|.:...:  .:|          |.|....|..:.:| ||..:.:| :|::  
Zfish   170 GVIDGKRIAVQSPGNSATFL--YDYKGTFSVVLLTLTDADYRFLVVDVGSCGSSSDVG-IFTNSA 231

  Fly   275 -------------APNTLTAIPEF-RINSRLVPAFVLAPVYQNYPLRPWLLQRYTD-PTAPHEHD 324
                         ||..|...||. ::|..:|       ..:.:||:|:||:.|.. ...|....
Zfish   232 LGKALQDGAFNFPAPAELPGAPELGKVNHVIV-------ANETFPLKPYLLRPYPGRQLLPEMKV 289

  Fly   325 FNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHTASCIITAAAVLHNL-------LEELSEPH 382
            ||......:::|:.....|..|:.|..:.|.:|...|...:.||.:|.|.       :::|.|  
Zfish   290 FNCRLSRARQVSENCFSNLSQRFRFFQRRLQVSPAVADSAVKAACILCNYVSPSEQNIQDLQE-- 352

  Fly   383 MLEWGNSVDVSKFRAEPLSDSVSEDAESHAALEVRDFLARTISS 426
              :.|:...|    .|||.......| ||.|..||:...:..:|
Zfish   353 --DDGSGCVV----IEPLRQMGGYRA-SHEAQSVRNTYKKYFNS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32095NP_729755.1 ATHILA <66..129 CDD:251715 11/35 (31%)
DDE_Tnp_4 <304..373 CDD:304434 19/69 (28%)
LOC103911715XP_009303385.1 DDE_Tnp_4 172..338 CDD:290096 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D822378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.