Sequence 1: | NP_001189086.1 | Gene: | Vha16-3 / 317846 | FlyBaseID: | FBgn0028667 | Length: | 158 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001185404.1 | Gene: | AVA-P4 / 843898 | AraportID: | AT1G75630 | Length: | 200 | Species: | Arabidopsis thaliana |
Alignment Length: | 195 | Identity: | 99/195 - (50%) |
---|---|---|---|
Similarity: | 127/195 - (65%) | Gaps: | 39/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MATDAADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMA 65
Fly 66 GIIAIYGLVVSVLIAGSL---SDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVR----- 122
Fly 123 -----------------------------GTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 158
Fly 159 158 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vha16-3 | NP_001189086.1 | V_ATP_synt_C | 16..121 | CDD:130170 | 66/107 (62%) |
ATP-synt_Vo_c_ATP6C_rpt2 | 91..156 | CDD:349416 | 48/98 (49%) | ||
AVA-P4 | NP_001185404.1 | V_ATP_synt_C | 14..122 | CDD:130170 | 66/107 (62%) |
ATP-synt_C | 95..191 | CDD:278563 | 46/95 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 96 | 1.000 | Domainoid score | I2452 |
eggNOG | 1 | 0.900 | - | - | E1_COG0636 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 200 | 1.000 | Inparanoid score | I1314 |
OMA | 1 | 1.010 | - | - | QHG53914 | |
OrthoDB | 1 | 1.010 | - | - | D1534092at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001101 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8409 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100711 | |
Panther | 1 | 1.100 | - | - | O | PTHR10263 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X666 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
13 | 12.840 |