DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and AVA-P2

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_564098.2 Gene:AVA-P2 / 838579 AraportID:AT1G19910 Length:165 Species:Arabidopsis thaliana


Alignment Length:160 Identity:98/160 - (61%)
Similarity:127/160 - (79%) Gaps:7/160 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATDAADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAG 66
            :|.:.|:..|    |||.:|||:|::||.:||||||||||.|:|:|.||||||:||||:||||||
plant     3 STFSGDETAP----FFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG 63

  Fly    67 IIAIYGLVVSVLIAGSL---SDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQP 128
            ::.||||:::|:|:..:   :.||.:..||.||::||:.|.|||:||.|||||||||||..||||
plant    64 VLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQP 128

  Fly   129 RLFVGMILILIFAEVLGLYGLIVAIYLYTK 158
            :|||||||||||||.|.||||||.|.|.::
plant   129 KLFVGMILILIFAEALALYGLIVGIILSSR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 66/107 (62%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 48/64 (75%)
AVA-P2NP_564098.2 V_ATP_synt_C 13..121 CDD:130170 66/107 (62%)
ATP-synt_Vo_c_ATP6C_rpt2 89..156 CDD:349416 48/66 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2452
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.