DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and ATP6V0C

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001185498.1 Gene:ATP6V0C / 527 HGNCID:855 Length:155 Species:Homo sapiens


Alignment Length:151 Identity:120/151 - (79%)
Similarity:134/151 - (88%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYG 72
            |..|.|:.||..|||::|::||||||||||||||||||||:|||||.||||||||||||||||||
Human     5 KSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYG 69

  Fly    73 LVVSVLIAGSLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILI 137
            |||:||||.||:|..::.|.::.|.||||||.:||||||||||||||||||||||||||||||||
Human    70 LVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILI 134

  Fly   138 LIFAEVLGLYGLIVAIYLYTK 158
            |||||||||||||||:.|.||
Human   135 LIFAEVLGLYGLIVALILSTK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 81/104 (78%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 55/64 (86%)
ATP6V0CNP_001185498.1 V_ATP_synt_C 13..118 CDD:130170 81/104 (78%)
ATP-synt_Vo_c_ATP6C_rpt2 86..153 CDD:349416 55/66 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143868
Domainoid 1 1.000 109 1.000 Domainoid score I6366
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 233 1.000 Inparanoid score I3429
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - otm40490
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.760

Return to query results.
Submit another query.