DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and ATP5MC1

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001002027.1 Gene:ATP5MC1 / 516 HGNCID:841 Length:136 Species:Homo sapiens


Alignment Length:63 Identity:23/63 - (36%)
Similarity:33/63 - (52%) Gaps:6/63 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 AAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 155
            |...:||.||..||  ||.|..:.:.|.|:.|    :||...||....:|.:||:.|:||..:
Human    72 AGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 10/23 (43%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 23/63 (37%)
ATP5MC1NP_001002027.1 ATP9 62..136 CDD:164765 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.