DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and VhaPPA1-2

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster


Alignment Length:157 Identity:54/157 - (34%)
Similarity:82/157 - (52%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVVSVLI 79
            |.:..||...|...|.||||.|....|..:|...|..|.:..|::|.|:....:|||||:.::|:
  Fly    51 FLWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILL 115

  Fly    80 AGSLSDSYTIR-------------KGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLF 131
            :|:::...::|             .|:....|||.||...:|.|.|:||||.......|....||
  Fly   116 SGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALF 180

  Fly   132 VGMILILIFAEVLGLYGLIVAIYLYTK 158
            |.::::.||...:||:|||||||:.:|
  Fly   181 VKILIVEIFGSAIGLFGLIVAIYMTSK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 37/117 (32%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 28/64 (44%)
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 35/109 (32%)
ATP-synt_C 143..204 CDD:278563 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.