DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and Vha16-2

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster


Alignment Length:154 Identity:117/154 - (75%)
Similarity:131/154 - (85%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIA 69
            ||..::|:|:||.|..|||.||||:.|||:||||.||.|||.|||.||::|||:|||||||||||
  Fly     4 AALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIA 68

  Fly    70 IYGLVVSVLIAGSLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 134
            |||||||||||||:.|.||:...|:||.||||||..||.||.||||.|||||||||:||||||||
  Fly    69 IYGLVVSVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGM 133

  Fly   135 ILILIFAEVLGLYGLIVAIYLYTK 158
            :|||||||||.|||||||||||||
  Fly   134 VLILIFAEVLALYGLIVAIYLYTK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 76/104 (73%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 52/64 (81%)
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 113/144 (78%)
ATP-synt_C 15..120 CDD:294318 76/104 (73%)
ATP-synt_C 94..154 CDD:278563 50/59 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444255
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1211.860

Return to query results.
Submit another query.