DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and atp6v0cb

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_991117.1 Gene:atp6v0cb / 325402 ZFINID:ZDB-GENE-030131-4127 Length:153 Species:Danio rerio


Alignment Length:148 Identity:123/148 - (83%)
Similarity:135/148 - (91%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVV 75
            |.||.||..|||::|::||||||||||||||||||||:|||||||||||||||||||||||||||
Zfish     6 PEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 70

  Fly    76 SVLIAGSLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIF 140
            :||||.|:||..|:.|.::||.||||||.:|||||||||||||||||||||||||||||||||||
Zfish    71 AVLIANSISDKITLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIF 135

  Fly   141 AEVLGLYGLIVAIYLYTK 158
            ||||||||||||:.|.||
Zfish   136 AEVLGLYGLIVALILSTK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 84/104 (81%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 56/64 (88%)
atp6v0cbNP_991117.1 V_ATP_synt_C 11..116 CDD:130170 84/104 (81%)
ATP-synt_Vo_c_ATP6C_rpt2 84..151 CDD:349416 56/66 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576805
Domainoid 1 1.000 109 1.000 Domainoid score I6291
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 244 1.000 Inparanoid score I3275
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm6565
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.