DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and vma3

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_594799.1 Gene:vma3 / 2542471 PomBaseID:SPAC1B3.14 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:158 Identity:112/158 - (70%)
Similarity:131/158 - (82%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATDAADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMA 65
            |:||..    |.|:.|||.||..:||:|::.||||||||:|.||:||.|:||:||:|:.||||||
pombe     1 MSTDLC----PVYAPFFGVMGCTAAIVFASFGAAYGTAKAGVGISAMGVLRPDLIVKNTIPVVMA 61

  Fly    66 GIIAIYGLVVSVLIAGSLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRL 130
            ||||||||||||||:|:|....::..|:|.|.||||||.||||||||||||||||||||||||||
pombe    62 GIIAIYGLVVSVLISGNLKQILSLYSGFIQLGAGLSVGLAGLAAGFAIGIVGDAGVRGTAQQPRL 126

  Fly   131 FVGMILILIFAEVLGLYGLIVAIYLYTK 158
            ||.|||||||||||||||||||:.|.|:
pombe   127 FVAMILILIFAEVLGLYGLIVALLLNTR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 73/104 (70%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 56/64 (88%)
vma3NP_594799.1 V_ATP_synt_C 12..117 CDD:130170 73/104 (70%)
PRK09621 13..151 CDD:236595 104/137 (76%)
ATP-synt_C 92..151 CDD:278563 54/58 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I1674
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 220 1.000 Inparanoid score I907
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - otm47033
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.