DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and vha-2

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_499166.1 Gene:vha-2 / 187779 WormBaseID:WBGene00006911 Length:161 Species:Caenorhabditis elegans


Alignment Length:160 Identity:110/160 - (68%)
Similarity:129/160 - (80%) Gaps:3/160 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATDAADKDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMA 65
            |:.|....::.||:.|||.||||||.||:.||||||||||..||.:|.||||||||||:|||:||
 Worm     1 MSYDLETAERAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMA 65

  Fly    66 GIIAIYGLVVSVLIAG---SLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQ 127
            |||.||||||::::.|   |.|..|.:.||:.||||||:.|..||.||:||||||||||||||||
 Worm    66 GIIGIYGLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQ 130

  Fly   128 PRLFVGMILILIFAEVLGLYGLIVAIYLYT 157
            |||||||||||||:|||||||:|||:.|.|
 Worm   131 PRLFVGMILILIFSEVLGLYGMIVALILGT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 73/107 (68%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 52/64 (81%)
vha-2NP_499166.1 V_ATP_synt_C 16..124 CDD:130170 73/107 (68%)
ATP-synt_Vo_c_ATP6C_rpt2 92..158 CDD:349416 52/65 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I4404
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 210 1.000 Inparanoid score I2374
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm4729
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.