DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-3 and Atp6v0c

DIOPT Version :9

Sequence 1:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001348460.1 Gene:Atp6v0c / 11984 MGIID:88116 Length:214 Species:Mus musculus


Alignment Length:157 Identity:126/157 - (80%)
Similarity:141/157 - (89%) Gaps:1/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TDAAD-KDKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAG 66
            :|.|| |:.|.||.|||.|||:||::|||:||||||||||||||||:||||||||||||||||||
Mouse    58 SDMADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 122

  Fly    67 IIAIYGLVVSVLIAGSLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLF 131
            |||||||||:||||.||:|..|:.:.::.|.||||||.:||||||||||||||||||||||||||
Mouse   123 IIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLF 187

  Fly   132 VGMILILIFAEVLGLYGLIVAIYLYTK 158
            |||||||||||||||||||||:.|.||
Mouse   188 VGMILILIFAEVLGLYGLIVALILSTK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 83/104 (80%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 54/64 (84%)
Atp6v0cNP_001348460.1 V_ATP_synt_C 72..177 CDD:130170 83/104 (80%)
ATP-synt_C 152..211 CDD:306615 54/58 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834104
Domainoid 1 1.000 109 1.000 Domainoid score I6373
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 238 1.000 Inparanoid score I3359
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - otm42564
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.710

Return to query results.
Submit another query.