DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and Elovl4

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:247 Identity:105/247 - (42%)
Similarity:152/247 - (61%) Gaps:3/247 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLELY 80
            |:|..:|||:.|.|....:.::|||.|...|||....:|.|:|..|..::..||.||.:|..||:
Mouse    34 DKRVADWPLMQSPWPTISISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELF 98

  Fly    81 AATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHHS 145
            ..:.:..|::.||....|.|.:|:|:..|.||:::||.:|:.||.|||||:|.:|:||||||||.
Mouse    99 MGSYNAGYSYICQSVDYSNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHC 163

  Fly   146 TMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFTI 210
            |||...||.|||:..|..:..|.:|||:|:|||.||.|:..||.:|::||||||||.||||||.:
Mouse   164 TMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHV 228

  Fly   211 IFFWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKFYMQKYT---VSAVGK 259
            .....:..|...|.:..|:..::..|::.|:|:|..||.:.|.   .|..||
Mouse   229 TIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKQSKTGK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 102/240 (43%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 99/235 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 3/8 (38%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849282
Domainoid 1 1.000 237 1.000 Domainoid score I2313
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I3157
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8727
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.