DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and AT3G06470

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_187298.1 Gene:AT3G06470 / 819824 AraportID:AT3G06470 Length:278 Species:Arabidopsis thaliana


Alignment Length:283 Identity:90/283 - (31%)
Similarity:122/283 - (43%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NWPLVDSF-WT-----------VPVLLSIYL---LMVRYAPKWTTRHKPLQLRAPLFCHSLAMVF 70
            |.|.:.:| |.           |.|::|:||   .::|.|........|..|:.....|||.:..
plant    14 NHPYISNFTWIEGETLGSTVFFVSVVVSVYLSATFLLRSAIDSLPSLSPRILKPITAVHSLILCL 78

  Fly    71 LNGYICLELYAATRDLDYNFGC----QPCRVSFDPHEMRLTKA-------------FWW---FYI 115
            |:             |....||    .....|.|| ..|...|             |:|   ||:
plant    79 LS-------------LVMAVGCTLSITSSHASSDP-MARFLHAICFPVDVKPNGPLFFWAQVFYL 129

  Fly   116 SKILEFADTAFFILRQKWSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMI--NSFVHIIMY 178
            ||||||.||...||.:...:|||||||||:|:.|.|::   |:.|..:..|..:  ||.||:|||
plant   130 SKILEFGDTILIILGKSIQRLSFLHVYHHATVVVMCYL---WLRTRQSMFPIALVTNSTVHVIMY 191

  Fly   179 GYYALSVLGPRVQRFLWWKRYLTGLQLVQFTIIFFWASQMLVR-----GCEYGTWITLSMAIYSL 238
            |||.|..:|.|.:    |||.:|..|:|||...|..:..||..     ||. |.|.....|.::.
plant   192 GYYFLCAVGSRPK----WKRLVTDCQIVQFVFSFGLSGWMLREHLFGSGCT-GIWGWCFNAAFNA 251

  Fly   239 PFLFMFGKFYMQKYTVSAVGKKP 261
            ..|.:|..|:.:.|.     |||
plant   252 SLLALFSNFHSKNYV-----KKP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 86/278 (31%)
AT3G06470NP_187298.1 ELO 43..272 CDD:395916 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3313
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.