DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and AT3G06460

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:269 Identity:83/269 - (30%)
Similarity:122/269 - (45%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PLVDSF-WT-----------VPVLLSIYL---LMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFLN 72
            |.:.:| ||           |.|::|:||   .::||.........|..|:.....|||.:..|:
plant    16 PYIANFTWTEGETLGSTVFFVFVVVSLYLSATFLLRYTVDSLPTLGPRILKPITAVHSLILFLLS 80

  Fly    73 GYICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKA-------------FWW---FYISKILEF 121
                         |....||....:|....:.||..|             |:|   ||:||||||
plant    81 -------------LTMAVGCTLSLISSSDPKARLFDAVCFPLDVKPKGPLFFWAQVFYLSKILEF 132

  Fly   122 ADTAFFILRQKWSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPA--MINSFVHIIMYGYYALS 184
            .||...||.:...:|||||||||:|:.:.|::   |:.|..:..|.  ::||.||:||||||.|.
plant   133 VDTLLIILNKSIQRLSFLHVYHHATVVILCYL---WLRTRQSMFPVGLVLNSTVHVIMYGYYFLC 194

  Fly   185 VLGPRVQRFLWWKRYLTGLQLVQFTI-IFFWASQMLVR-----GCEYGTWITLSMAIYSLPFLFM 243
            .:|.|.:    ||:.:|..|:|||.. :...|:.||..     ||. |.|......:::...|.:
plant   195 AIGSRPK----WKKLVTNFQMVQFAFGMGLGAAWMLPEHYFGSGCA-GIWTVYFNGVFTASLLAL 254

  Fly   244 FGKFYMQKY 252
            |..|:.:.|
plant   255 FYNFHSKNY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 83/269 (31%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.