DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and ELOVL7

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001098028.1 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:242 Identity:89/242 - (36%)
Similarity:134/242 - (55%) Gaps:5/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLEL 79
            |.|..:|.|:.|.....:||..|:..| ...||.....||.:|:..:..::..:|..:.|:|.|.
Human    22 DPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEF 86

  Fly    80 YAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHH 144
            ..:...:.|:|.|.....|..|..:|:.:..|.:|.||.:|..||.||:||:|.||::||||:||
Human    87 VMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHH 151

  Fly   145 STMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFT 209
            :.|....|..:|:...|.....|::|:.||::||.||.||.|||..|::||||:|||.||||||.
Human   152 TIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFV 216

  Fly   210 IIFFWASQ-MLVRGCEY--GTWITLSMAIYSLPFLFMFGKFYMQKYT 253
            |:....|| ..:..|:|  ..:..:.|: ||..||.:|..|:.:.||
Human   217 IVAIHISQFFFMEDCKYQFPVFACIIMS-YSFMFLLLFLHFWYRAYT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 86/235 (37%)
ELOVL7NP_001098028.1 ELO 30..269 CDD:307345 86/234 (37%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.