DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elovl1

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:249 Identity:90/249 - (36%)
Similarity:137/249 - (55%) Gaps:3/249 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FHPFPDQPDERTRNWPLVDS-FWTVPVLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFL 71
            :|.|....|.|..::||:.| |....:|||....::...|:.....||..|:..:..::.::|.|
 Frog    12 YHNFMKGADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLMVVYNFSLVAL 76

  Fly    72 NGYICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQL 136
            :.||..|...:.....|.:.|.|..||..|..:|:.:..|.|..||.:|..||.||::|:|.||:
 Frog    77 SAYIVYEFLMSGWLTGYTWRCDPVDVSDTPMALRMVRVAWLFLFSKFIELLDTVFFVVRKKNSQI 141

  Fly   137 SFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLT 201
            :|||::|||.:....|..:|:.|.|.....|||||.||:|||.||.||..|||.|::||||:::|
 Frog   142 TFLHIFHHSVLPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAAGPRFQKYLWWKKHMT 206

  Fly   202 GLQLVQFTIIFFWASQ-MLVRGCEYGTWITLSMA-IYSLPFLFMFGKFYMQKYT 253
            .:||:||.::....|| ..:..|:|...|.:.:. ||...|..:|..|:.|.||
 Frog   207 AIQLIQFVLVSIHISQYYFMSSCDYQYPIFIHLIWIYGTVFFILFSNFWYQAYT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 86/234 (37%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.