DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elovl5

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:240 Identity:85/240 - (35%)
Similarity:138/240 - (57%) Gaps:8/240 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLL--SIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLE 78
            |.|.|.|.|:|::  ||.:|  ::||.:|...||:.....|:..|..|..::|.:..|:.|:..|
 Frog    20 DPRVRGWLLLDNY--VPTILFTALYLFIVWRGPKYMQNRPPVSCRGILVVYNLGLTLLSLYMFYE 82

  Fly    79 LYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYH 143
            |.....:..|||.||......|. :.::.:..||:|.||::||.||.|||||:...|::.|||||
 Frog    83 LVTGVWEGGYNFFCQDTNSGGDA-DTKIVRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYH 146

  Fly   144 HSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQF 208
            |::|....|.::.|:|.|.:|..|.:|||:|::||.||.||.: |.::.:||||:|:|..||.||
 Frog   147 HASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAI-PAMRPYLWWKKYITQCQLTQF 210

  Fly   209 TIIFFWASQMLVRGCEYGT-WITLSMAIYSLPFLFMFGKFYMQKY 252
            .:.....:..::..|::.. |:..... |.:..:.:||.||::.|
 Frog   211 VLTMTQTTCAMIWPCKFPMGWLYFQNC-YMISLIILFGNFYIKTY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 81/233 (35%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 81/232 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.