DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elovl7

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001005456.1 Gene:elovl7 / 448054 XenbaseID:XB-GENE-942805 Length:299 Species:Xenopus tropicalis


Alignment Length:241 Identity:88/241 - (36%)
Similarity:129/241 - (53%) Gaps:3/241 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLEL 79
            |.|..:|||:.:.....:::..|:..| ...|:.....||..|:..:.|::|.||..:.|:|.|.
 Frog    22 DPRVEDWPLMSTPIPQTIIIGAYIYFVTSLGPRIMENRKPFALKEIMACYNLFMVLFSLYMCYEF 86

  Fly    80 YAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHH 144
            ..:.....|::.|.....|..|..:|:....|.||.||.:|..||.||:||:|.||::|||||||
 Frog    87 LMSGWAAGYSYRCDIVDYSQSPQALRMAWTCWLFYFSKFIELLDTVFFVLRKKNSQITFLHVYHH 151

  Fly   145 STMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFT 209
            |.|....|..:|:...|.....|::|..||:|||.||.||.|||..|::||||:|:|.:||.||.
 Frog   152 SIMPWTWWFGVKFAAGGLGTFHALVNCVVHVIMYSYYGLSALGPAYQKYLWWKKYMTSIQLTQFL 216

  Fly   210 IIFFWASQ-MLVRGCEYGTWITLSMA-IYSLPFLFMFGKFYMQKYT 253
            ::.|...| ..:..|.|...|.|.:. :|...||.:|..|:...||
 Frog   217 MVTFHIGQFFFMENCPYQYPIFLYVIWLYGFVFLLLFLNFWFHAYT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 85/234 (36%)
elovl7NP_001005456.1 ELO 29..228 CDD:395916 74/198 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.