DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and CG8534

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster


Alignment Length:248 Identity:78/248 - (31%)
Similarity:127/248 - (51%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLELYAATRDL 86
            ||:.|.|....::|:|||.| :...|:....||..||..:..:::..:..||.|   |.|....|
  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVI---LIAGLHFL 80

  Fly    87 ----DYNFGCQPCRVSFDPHEMRLTKAFWW---FYISKILEFADTAFFILRQKWSQLSFLHVYHH 144
                .|:..| ..::..| ||:: ::..|.   ::.:|.::..:|.||:||:|..|:|||||:||
  Fly    81 FVLKAYDLRC-ITKLPLD-HELK-SRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHH 142

  Fly   145 STMFVFCWILIKWMPTGSTYVP-AMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQF 208
            ..|....::.|.:...|.|..| .::|..||:|||.||.||.:...||... ||:|:|.:|||||
  Fly   143 LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLVQF 206

  Fly   209 TIIFFWASQMLVR-GCEYGTWITLSMAIYSLPFLFMFGKFYMQKYTVSAVGKK 260
            .::....|..|:: .|.....:..:....|..|:.||..||:..|.::...:|
  Fly   207 ILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 77/246 (31%)
CG8534NP_649955.1 ELO 19..259 CDD:366492 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473078
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.