DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elovl1b

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001315523.1 Gene:elovl1b / 406725 ZFINID:ZDB-GENE-040426-2755 Length:320 Species:Danio rerio


Alignment Length:240 Identity:91/240 - (37%)
Similarity:139/240 - (57%) Gaps:3/240 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMVRYA-PKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLEL 79
            |.|.:::||::|.:::..:|..||..|.|| ||:....||.||:..:..::|::|.|:.||..|.
Zfish    21 DPRLKDYPLMESPFSMTAILLAYLFFVLYAGPKFMANRKPFQLKEAMIIYNLSLVGLSAYIVYEF 85

  Fly    80 YAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHH 144
            ..:.....|.:.|.||..|..|..:|:.:..|.|..||.:|..||.||:||:|.||::|||::||
Zfish    86 LMSGWATGYTWRCDPCDYSNSPQGLRMARVAWLFLFSKFIELMDTVFFVLRKKHSQITFLHIFHH 150

  Fly   145 STMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFT 209
            |.|....|..:..:|.|.....||:||.||:|||.||.||..|||.|:|||||:|:|.:||.||.
Zfish   151 SFMPWTWWWGVSIVPGGMGSFHAMVNSCVHVIMYFYYGLSAAGPRFQKFLWWKKYMTAIQLTQFV 215

  Fly   210 IIFFWASQ-MLVRGCEYGTWITLSMA-IYSLPFLFMFGKFYMQKY 252
            ::....|| ..:..|::...:.:.:. :|...|..:|..|:.|.|
Zfish   216 LVSLHVSQWYFMESCDFQVPVIIHLIWLYGTFFFVLFSNFWYQAY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 89/233 (38%)
elovl1bNP_001315523.1 ELO 28..268 CDD:279492 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.