DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elovl5

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 / 393425 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio


Alignment Length:246 Identity:90/246 - (36%)
Similarity:137/246 - (55%) Gaps:4/246 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLELY 80
            |.|...|.|:|.:....:...:|||:|...||:....:....||.|..::|.:..|:.|:..||.
Zfish    20 DLRVTGWFLLDDYIPTFIFTVMYLLIVWMGPKYMKNRQAYSCRALLVPYNLCLTLLSLYMFYELV 84

  Fly    81 AATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHHS 145
            .:.....|||.||......|. :.|:....||:|.||::||.||.|||||:...|::|||||||:
Zfish    85 MSVYQGGYNFFCQNTHSGGDA-DNRMMNVLWWYYFSKLIEFMDTFFFILRKNNHQITFLHVYHHA 148

  Fly   146 TMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFTI 210
            ||....|.::.|:|.|.:|..|..|||:|::||.||.||.: |.::.:||||:|:|..|||||.:
Zfish   149 TMLNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAV-PALRPYLWWKKYITQGQLVQFVL 212

  Fly   211 IFFWASQMLVRGCEYGT-WITLSMAIYSLPFLFMFGKFYMQKYTVSAVGKK 260
            ..|..|..:|..|.:.. |:...:: |.:..:.:|..||:|.|...:..:|
Zfish   213 TMFQTSCAVVWPCGFPMGWLYFQIS-YMVTLILLFSNFYIQTYKKRSGSRK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 86/237 (36%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594868
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.