DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and Elo68beta

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster


Alignment Length:252 Identity:191/252 - (75%)
Similarity:213/252 - (84%) Gaps:0/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HPFPDQPDERTRNWPLVDSFWTVPVLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFLNG 73
            :||.|..||||::||||.|.|.:..||::||||||||||||.|.||||||.|||||||||:||||
  Fly    16 YPFADLADERTQDWPLVKSPWNIIALLALYLLMVRYAPKWTARCKPLQLRVPLFCHSLAMIFLNG 80

  Fly    74 YICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSF 138
            |||||...|:..|.|||.||.||||.||||:|:..|.|||||||||||.||||||||.||:||||
  Fly    81 YICLEFLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSF 145

  Fly   139 LHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGL 203
            ||||||||||:|||..:||:|||||:.|:|||||||:|||.||||||||||||||||||||||||
  Fly   146 LHVYHHSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGL 210

  Fly   204 QLVQFTIIFFWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKFYMQKYTVSAVGKK 260
            ||||||||||||||::.||||||.|:|...|.|.:|||||||:||.|||.||||.||
  Fly   211 QLVQFTIIFFWASQLVFRGCEYGKWLTPIGAAYMVPFLFMFGRFYAQKYCVSAVVKK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 181/236 (77%)
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 171/218 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468912
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 1 1.000 - - H135903
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm24395
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1211.800

Return to query results.
Submit another query.