DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and Elovl7

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:242 Identity:84/242 - (34%)
Similarity:132/242 - (54%) Gaps:5/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLEL 79
            |.|..||.|:.|.....::|.:|:..| ...||.....||.:|:..:..::..:|..:.|:|.|.
  Rat    22 DPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEF 86

  Fly    80 YAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHH 144
            ..:.....|:|.|.....|..|..||:....|.:|.||.:|..||.||:||:|.||::||||:||
  Rat    87 VMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHH 151

  Fly   145 STMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFT 209
            :.|....|..:|:...|.....|::|:.||::||.||.|..:||..|::||||::||.||||||.
  Rat   152 TIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFV 216

  Fly   210 IIFFWASQM-LVRGC--EYGTWITLSMAIYSLPFLFMFGKFYMQKYT 253
            ::.....|: .:..|  :|..::.:.|: |...||.:|..|:.:.||
  Rat   217 LVTVHIGQIFFMEDCNYQYPVFLYIIMS-YGCIFLLLFLHFWYRAYT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 80/235 (34%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 80/234 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.