DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and tea

DIOPT Version :10

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster


Alignment Length:48 Identity:9/48 - (18%)
Similarity:18/48 - (37%) Gaps:10/48 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 MFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFL 194
            ::..||...:|:|.........:|:          .|..:.|.::|.|
  Fly  1336 LYACCWAHNQWLPRAPQIANETLNA----------ELGEVEPVIERIL 1373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:460083 9/48 (19%)
teaNP_724855.2 None

Return to query results.
Submit another query.