DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and CG31141

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:261 Identity:80/261 - (30%)
Similarity:129/261 - (49%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PFPDQPDERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLN- 72
            |:.|     ::..||......:.::|..|||:| :...|:....:|..||..|..:::..:|.| 
  Fly     8 PYAD-----SKQLPLATGPGPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFYNI 67

  Fly    73 -----GYICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWW-------FYISKILEFADTA 125
                 ||..:.::.     .|||.|.  .|....|.::.     |       :||:||::..||.
  Fly    68 MMLLPGYYFMLVFQ-----PYNFRCM--TVLQQDHPLKN-----WERCISYAYYINKIVDLLDTV 120

  Fly   126 FFILRQKWSQLSFLHVYHHSTMFVFCWILIKWMP-TGSTYVPAMINSFVHIIMYGYYALSVLGPR 189
            |.:||:|:||::||||:||..|....:::|::.. .|..:.....|.||||.||.||..::.|..
  Fly   121 FCVLRKKYSQITFLHVFHHVLMPSAGYLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYYSAIKGNT 185

  Fly   190 VQRFLWWKRYLTGLQLVQFTIIF-FWASQMLVRGC--EYGTWITLSMAIYSLPFLFMFGKFYMQK 251
            |:    ||||||.:|::||.::| ..|...:.|.|  ..||...:|.:. ::.|: ||..||.|.
  Fly   186 VR----WKRYLTLMQMLQFLLMFGHCALTAMQRQCTASQGTLFLVSCSA-TIMFI-MFANFYFQC 244

  Fly   252 Y 252
            |
  Fly   245 Y 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 78/248 (31%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473117
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.