DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and Elovl4

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:247 Identity:105/247 - (42%)
Similarity:152/247 - (61%) Gaps:3/247 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMVRYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYICLELY 80
            |:|..:|||:.|.|....:.::|||.|...|||....:|.|:|..|..::..||.||.:|..||:
  Rat    34 DKRVEDWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELF 98

  Fly    81 AATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHHS 145
            ..:.:..|::.||....|.|.:|:|:..|.||:::||.:|:.||.|||||:|.:|:||||||||.
  Rat    99 MGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHC 163

  Fly   146 TMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFTI 210
            |||...||.|||:..|..:..|.:|||:|:|||.||.|:..||.:|::||||||||.||||||.:
  Rat   164 TMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHV 228

  Fly   211 IFFWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKFYMQKYT---VSAVGK 259
            .....:..|...|.:..|:..::..|::.|:|:|..||.:.|.   .|..||
  Rat   229 TIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKKSKTGK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 102/240 (43%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 100/236 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352905
Domainoid 1 1.000 238 1.000 Domainoid score I2222
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3071
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm8964
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.