DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elo-8

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001255110.1 Gene:elo-8 / 259739 WormBaseID:WBGene00001246 Length:292 Species:Caenorhabditis elegans


Alignment Length:297 Identity:62/297 - (20%)
Similarity:97/297 - (32%) Gaps:105/297 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FPDQPDERTRNWPLVDSFWTVPV-LLSIYLLMV------------RYAPKWTTRHKPLQLRAPLF 62
            ||......|.||.|      :|: ||.|:.:.|            .|..:|...:...||...:.
 Worm     2 FPYSWLSSTINWSL------LPIHLLGIFYVFVAFNFRPSHISDRSYLKEWYYYNCVFQLGLGIL 60

  Fly    63 -----------------CHS--LAMVFLNGYICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTK 108
                             |||  |...|.:|.:.                                
 Worm    61 MIPEILTSSLSGWHYSVCHSGTLYTGFFSGSVV-------------------------------- 93

  Fly   109 AFWWFYISKILEFADTAFFILRQKWSQLSFLHVYHH--STMFVFC-----WILIKWMPTGSTYVP 166
            |.|.|  :|:::..:| ..:|......|: :|:.||  |..|.|.     :.|.:|:        
 Worm    94 AIWTF--TKVVDLLET-MLLLYDARRPLT-IHIIHHFLSLSFAFTFYSQNFALHRWI-------- 146

  Fly   167 AMINSFVHIIMYGYYA-LSVLGPRVQRFLW---WKRYLTG--LQLVQFTIIFFWASQMLVRG--C 223
            ...|...|:.:|.|.: ..:|.      .|   |....:.  |||:...|..|.|:..|.||  |
 Worm   147 VFFNLTAHVFLYAYLSGFKILN------RWTPCWVAVCSSQMLQLILPFIATFSAAAKLARGTRC 205

  Fly   224 EYGTWITLSMAIYSLPFLFMFGKFYMQKYTVSAVGKK 260
            :......|::.|.....:.:|.:||..:  |.|..||
 Worm   206 DANALGLLTLQIGLGVLIILFAEFYWSR--VQAFRKK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 55/283 (19%)
elo-8NP_001255110.1 ELO 14..243 CDD:295675 57/285 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.