DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:295 Identity:74/295 - (25%)
Similarity:125/295 - (42%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HPFP-------DQPDERTRNW------------PLVDSFW-TVPVLLSIYLLMVRYAPKWTTRHK 53
            |||.       :|...:|..|            |:  |.| :|.|.::.|.:::.......|..|
pombe    18 HPFGVDLWHLFEQLSIKTIGWNPSEFEYIPGKTPM--SQWSSVIVSITAYYVIILSGRAIMTNRK 80

  Fly    54 PLQLRAPLFCHSLAMVFLNGYICLELYAATRDLDYNF---GCQPCRVSFDPHEMRLTKAFWWFYI 115
            ||:.|.....|:..:..::|.:   |.....::..|:   |...|.........||...::..|:
pombe    81 PLKQRRLFQLHNFILTIISGAL---LALLVEEVFRNYMRNGLFYCVCDSRHFTQRLVTLYYLNYL 142

  Fly   116 SKILEFADTAFFILRQKWSQLSFLHVYHHSTMFVFCW------ILIKWMPTGSTYVPAMINSFVH 174
            :|.||..||.|..|::|  .|:|||.|||....:.|:      ..::|...|       :|.:||
pombe   143 TKYLELMDTVFLFLKKK--PLAFLHCYHHGITALLCFTQLLGRTSVQWGVIG-------LNLYVH 198

  Fly   175 IIMYGYYALSVLGPRVQRFLWWKRYLTGLQLVQFTIIFFWASQMLVRGCEYGTWITLSMAIYS-L 238
            :|||.||.|:..|.||    |||:::|.:|::||.:      .:::  |.:||:..::...:. |
pombe   199 VIMYSYYFLAACGRRV----WWKQWVTRVQIIQFVL------DLIL--CYFGTYSHIAFRYFPWL 251

  Fly   239 P---------------------FLFMFGKFYMQKY 252
            |                     :||:|..||:..|
pombe   252 PHVGDCSGSLFAAFFGCGVLSSYLFLFIGFYINTY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 68/262 (26%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.