DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and CG30008

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:261 Identity:74/261 - (28%)
Similarity:117/261 - (44%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASLGISFHPFPDQPDERTRNWPLVDSFWTVPVLLSIYLLMVRYA-PKWTTRHKPLQLRAPLFCHS 65
            ||..|:..|..:.|       .:....|.:..:|.:||..|..| |.:....||.:|:..:..|:
  Fly     3 ASASINLQPVVNVP-------TIYKDPWYMITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHN 60

  Fly    66 LAMVFLNGYICLELYAATRDLDYNFGCQPCR-VSFDPHEMR--LTKAFWWFYISKILEFADTAFF 127
            ...|....|...|:...|.:..|.|  ..|| :...|..:|  ...|::.|:: ||.|..:|..|
  Fly    61 FIQVVSCIYAIKEVLYITDNTIYIF--WKCRDIGSSPELVRRYYNLAYFLFWL-KISELIETVIF 122

  Fly   128 ILRQKWSQLSFLHVYHHSTMFVFCWILIKWMPTGS-TYVPAMINSFVHIIMYGYYALSVLGPR-- 189
            :||:|.:|:|.||::||.:.....:.||.:...|| .|....:||.||:|||.||.::.:..:  
  Fly   123 VLRKKQNQVSKLHIFHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTL 187

  Fly   190 VQRFLWWKRYLTGLQLVQFTIIFFWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKFYMQKYTV 254
            ||.....|:.:|.:|:.||.:|....:..||. |.....:.|......|...:.|..||...|..
  Fly   188 VQALTPVKKCITVIQMTQFVLILTQVAFQLVL-CGMPPLVLLYFTTVILGMFYGFYDFYNSAYQA 251

  Fly   255 S 255
            |
  Fly   252 S 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 69/240 (29%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473096
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.