DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and elo-4

DIOPT Version :10

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_499056.1 Gene:elo-4 / 183367 WormBaseID:WBGene00001242 Length:291 Species:Caenorhabditis elegans


Alignment Length:77 Identity:18/77 - (23%)
Similarity:30/77 - (38%) Gaps:28/77 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PSSSFSINKLARR-------------KRSLPWQNQNDLYE----------ETLRAVGVSGVEVGT 107
            ||||   |..:|:             :|.||:|.....::          .|:|..|.|.::...
 Worm    88 PSSS---NAPSRKTIDLGHGSDLIYIQRFLPFQQSWTFFDYLDKHIPWTRPTIRVFGRSCLQPRD 149

  Fly   108 TVYITNLDQGVT 119
            |.|:.:  .|:|
 Worm   150 TCYVAS--SGLT 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:460083 18/77 (23%)
elo-4NP_499056.1 ELO 47..278 CDD:460083 18/77 (23%)

Return to query results.
Submit another query.