DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elo68alpha and Elovl6

DIOPT Version :9

Sequence 1:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:287 Identity:82/287 - (28%)
Similarity:118/287 - (41%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLGISFHPFPDQPDERTR-NWPLVDSFWTVPVLLS-IYLLMVRYAPKWTTRHKPLQLRAPLFC 63
            |:.|.:..:.|..|.:|... .|  :...|....|.| :|...:........:....:||.||..
  Rat     3 MSVLTLQEYEFEKQFNENEAIQW--MQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVL 65

  Fly    64 HSLAMVFLNGYICLE-----LY-AATRDLDYNFGCQPCRVSFDPHEMRLTKAFW--WFYISKILE 120
            .||.:...:.:..|.     || ..|:.|..:.    |..||  :...::| ||  .|.:||..|
  Rat    66 WSLTLAVFSIFGALRTGAYMLYILMTKGLKQSV----CDQSF--YNGPVSK-FWAYAFVLSKAPE 123

  Fly   121 FADTAFFILRQKWSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSV 185
            ..||.|.|||::  :|.|||.|||.|:.::.|...|.|..|..:...| |..||.:||.||||..
  Rat   124 LGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTM-NYGVHAVMYSYYALRA 185

  Fly   186 LGPRVQRFLWWKRYLTGLQLVQFTIIFFWASQMLVRGCEYG----TW--------------ITLS 232
            .|.||.|     ::...:.|.|.|       |||: ||...    .|              |..|
  Rat   186 AGFRVSR-----KFAMFITLSQIT-------QMLM-GCVINYLVFNWMQHDNDQCYSHFQNIFWS 237

  Fly   233 MAIYSLPFLFMFGKFYMQKYTVSAVGK 259
            ..:| |.:|.:|..|:.:.|    :||
  Rat   238 SLMY-LSYLLLFCHFFFEAY----IGK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 76/264 (29%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.