DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67c and Ir94h

DIOPT Version :9

Sequence 1:NP_729609.1 Gene:Ir67c / 317838 FlyBaseID:FBgn0052058 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster


Alignment Length:543 Identity:120/543 - (22%)
Similarity:216/543 - (39%) Gaps:120/543 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RFSSHSLIIACFKDSTRNRTLNGVKELLWGLQYLPILF-VVDSNMDFYFQQAL----RHGFIHVL 130
            |.||:..::||...::.:..|..:.|.|...:.:.:|. |.|....|...|.|    :|..::|:
  Fly    71 RHSSNLFVMACLSSTSYDGQLQLLAESLTRYRSVRVLIEVQDKEGSFLASQILLLCQQHSMLNVV 135

  Fly   131 ALNF------MNGSLYTYKPY-------------PKVEVHQIKDMQKFYKLTKLRNLQGQAVRTT 176
             |.|      :|...|...||             ||:.::|:||            |||..:|..
  Fly   136 -LYFSRWTRTLNVFSYLAFPYFKLLKQRLSGSLRPKIFINQLKD------------LQGYKIRVQ 187

  Fly   177 VETMTPRCFRYRNRHGQLVYAGYMYRMVKEFISTYNGTEEHVF-----GNVDTVPYKEGLAALKN 236
            .:...|..|.||:|||:....|:::|:|:.|..:..|..:.::     ..|....|.  :...:|
  Fly   188 PDLSPPNSFSYRDRHGECQVGGFLWRIVENFSKSLKGDTQVLYPTWAKAKVSAAEYM--IQFTRN 250

  Fly   237 GEIDM-----MPRIIHALEWYYFYRSHILYNIKTYIMVPWAEPLPKSLYF---IQPFRGTVWITI 293
            |..|:     |....|. |.|..| |:.:|:|....|:|..:||...:.|   :.|  |:..:.|
  Fly   251 GSSDIGVTTTMITFKHE-ERYRDY-SYPMYDISWCTMLPVEKPLSVEILFSHVLSP--GSALLLI 311

  Fly   294 MVSFVYASIVIWWIRYRQQGNSSLTQSFMDVLQLLFQLPLSKIWHFNMGTHQVVSFIVLFVFGFM 358
            :...::..||               ...:..|.:.|:..|     ..|.:.         :|..:
  Fly   312 LAFILFFLIV---------------PQLIKCLGITFRGRL-----IGMASR---------IFALV 347

  Fly   359 LTNLYTAQLSSYLTTGLFKSQINTFDDL---------FREKRTLLVESFDAEVLHNMTKEKIIQK 414
            :....:|||.|.|.:....::|.:||||         .|.:...|...|.|             |
  Fly   348 MLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFLDGGFRA-------------K 399

  Fly   415 EFESIILITSIEEVFKHRKSLNTSYAYEAYEDRIAFELSQQRYLRVPIFKILKEV--YDQRPVFV 477
            ...:..|..:..|::.:|...|||:||.....:.....:|||:...|:|:...::  ..:.|..:
  Fly   400 YASAFHLTENPNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYSTDLCFSSETPWGL 464

  Fly   478 ALRHGLPYVELFNNYLRRIFESGIWIKLQEDSFLEGIASGEISF----RKSKSREIKIFD--KDF 536
            .:.....|.|...::..:|.::|:..:....||.|.:.:|.::.    |.:..:.::|.|  |.:
  Fly   465 LIAPESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDLRKCW 529

  Fly   537 YFFAYILLGMGWCVSTIALFLEL 559
            ..||   :|:|  .||:...:||
  Fly   530 VIFA---VGLG--TSTVVFTIEL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir67cNP_729609.1 Lig_chan 288..500 CDD:278489 40/222 (18%)
Ir94hNP_651148.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.