DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67c and Ir87a

DIOPT Version :9

Sequence 1:NP_729609.1 Gene:Ir67c / 317838 FlyBaseID:FBgn0052058 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:422 Identity:88/422 - (20%)
Similarity:155/422 - (36%) Gaps:105/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GQLVYAGYMYRMVKEF---------ISTYNGTEEHVFGNVDTVPYKEGLAALKNGEIDMM----- 242
            |:|..:|..|.||:..         :...|....|:|            ..|.:|||:|:     
  Fly   405 GKLKLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLF------------QQLIDGEIEMIVGGID 457

  Fly   243 --PRIIHALEWYYFYRSHILYNIKTYIMVPWAEPLPKSLY----FIQPFRGTVWITIMVSFVYAS 301
              |.|..      |..|.|.|:...   :.|.....|..:    |:..|.......|.:..|..|
  Fly   458 EDPSISQ------FVSSSIPYHQDE---LTWCVARAKRRHGFFNFVATFNADAGFLIGIFVVTCS 513

  Fly   302 IVIWWIRYRQQGNS--SLTQSFMDVLQLL------------FQLPLSKIWHFNMGTHQVVSFIVL 352
            :|: |:..|..|..  :|...|...|::|            |.:.|.::            |.:.
  Fly   514 LVV-WLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFPITLRQL------------FALS 565

  Fly   353 FVFGFMLTNLYTAQLSSYLTTGLFKSQINTFDDLFREKRTLLVESFDAEVLHNMTKE----KIIQ 413
            |:.||..:|.|.:.|.|.|||.....||:|..:::..|.|::..|   |.:.::.|:    |.|:
  Fly   566 FLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTS---EHVRHLNKDGEIFKYIR 627

  Fly   414 KEFESII-LITSIEEVFKHRK-SLNTSYAYEAYEDRI------AFELSQQRYLRVPIFKILKEVY 470
            ::|:... |:..:.:..::.. ::..|..:..|..||      .|:..:..|:.:....:.|:.:
  Fly   628 EKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVYLVTMLLPKKYH 692

  Fly   471 DQRPVFVALRHGLPYVELFNNYLRRIFESGIWIKLQEDSFLEGIASGEISFRKSKSREIKIFDK- 534
                    |.|.:      |..::.|.|||...|...|..:..:...||:..:....:...||: 
  Fly   693 --------LLHQI------NPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPFKALTFDQF 743

  Fly   535 --DFYFFAYILLGMGWCVSTIALFLELWSFKY 564
              ...|...:||     |::.....||...||
  Fly   744 RGAIAFSGGLLL-----VASCVFAFELCYVKY 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir67cNP_729609.1 Lig_chan 288..500 CDD:278489 48/237 (20%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.