powered by:
Protein Alignment ghi and AT2G30942
DIOPT Version :9
Sequence 1: | NP_729495.1 |
Gene: | ghi / 317833 |
FlyBaseID: | FBgn0266124 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_973572.1 |
Gene: | AT2G30942 / 2745572 |
AraportID: | AT2G30942 |
Length: | 56 |
Species: | Arabidopsis thaliana |
Alignment Length: | 37 |
Identity: | 10/37 - (27%) |
Similarity: | 20/37 - (54%) |
Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 FRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNYS 50
:.|.:...|||::.|||...:.:.::| .|:..|:
plant 9 YLYNVTFGLYMLDWWERYLFNSLVLIL---MWFILYN 42
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ghi | NP_729495.1 |
None |
AT2G30942 | NP_973572.1 |
DUF3317 |
1..52 |
CDD:288612 |
10/37 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1627882at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.