powered by:
Protein Alignment ghi and R05G9.3
DIOPT Version :9
Sequence 1: | NP_729495.1 |
Gene: | ghi / 317833 |
FlyBaseID: | FBgn0266124 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495314.2 |
Gene: | R05G9.3 / 187627 |
WormBaseID: | WBGene00019905 |
Length: | 230 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 6/34 - (17%) |
Similarity: | 13/34 - (38%) |
Gaps: | 5/34 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 WFRYLMVTELYMVEKWERITIHVIFMVLFCVFWY 46
|.|.:....:.::. .|..|.:.|.|..::
Worm 149 WIRRVKDFNISLIS-----VIVTIIVTLMCYLFF 177
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.