powered by:
Protein Alignment ghi and SPTSSA
DIOPT Version :9
Sequence 1: | NP_729495.1 |
Gene: | ghi / 317833 |
FlyBaseID: | FBgn0266124 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_612145.2 |
Gene: | SPTSSA / 171546 |
HGNCID: | 20361 |
Length: | 71 |
Species: | Homo sapiens |
Alignment Length: | 49 |
Identity: | 18/49 - (36%) |
Similarity: | 29/49 - (59%) |
Gaps: | 15/49 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 SYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNYSVLLSLAGL 58
|:::::||:||.|||:|.|||.. || |:|:|:.|:
Human 14 SWFYYQYLLVTALYMLEPWERTV--------------FN-SMLVSIVGM 47
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ghi | NP_729495.1 |
None |
SPTSSA | NP_612145.2 |
SPT_ssu-like |
10..63 |
CDD:403091 |
18/49 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1627882at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.