DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ghi and SPTSSA

DIOPT Version :9

Sequence 1:NP_729495.1 Gene:ghi / 317833 FlyBaseID:FBgn0266124 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_612145.2 Gene:SPTSSA / 171546 HGNCID:20361 Length:71 Species:Homo sapiens


Alignment Length:49 Identity:18/49 - (36%)
Similarity:29/49 - (59%) Gaps:15/49 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNYSVLLSLAGL 58
            |:::::||:||.|||:|.|||..              || |:|:|:.|:
Human    14 SWFYYQYLLVTALYMLEPWERTV--------------FN-SMLVSIVGM 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ghiNP_729495.1 None
SPTSSANP_612145.2 SPT_ssu-like 10..63 CDD:403091 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627882at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.