DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDH1

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_014361.1 Gene:IDH1 / 855691 SGDID:S000004982 Length:360 Species:Saccharomyces cerevisiae


Alignment Length:345 Identity:138/345 - (40%)
Similarity:217/345 - (62%) Gaps:13/345 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 KASGEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNR 441
            |..|....:||:||||:|.||:.:|..|.||...|:.:|.:::....:.:|:    .:.:||:.|
Yeast    23 KKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGV----YEAVESLKR 83

  Fly   442 TKVGLKGPLMTPVG-TGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYS 505
            .|:||||...||.. ||..|||:.||:..::|||:...:||.||:|...|:|::.||||||||:|
Yeast    84 NKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFS 148

  Fly   506 GIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMA 570
            |:||..|.|||:|:|::||..:.|:|.:.|.:|....||.||||.::.:|::.||||...:.|:.
Yeast   149 GLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIG 213

  Fly   571 AKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNV 635
            .|....:|.:.|..:.::|..|.     .|.::|:||.|::||.|:.:..|.||||.||....|.
Yeast   214 QKEYPDIDVSSIIVDNASMQAVA-----KPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANF 273

  Fly   636 GTNGAIFE--SVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRT 698
            |.:.|:||  |.| ...||.|:::|||||::|||.:||:::||:|:|.:|.|||.:||.:....|
Yeast   274 GRDYAVFEPGSRH-VGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTT 337

  Fly   699 MDLGGKAKCSEYTDALIKNL 718
            .|:||.:..:::|:.:|..|
Yeast   338 RDIGGSSSTTDFTNEIINKL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 135/338 (40%)
IDH1NP_014361.1 mito_nad_idh 26..357 CDD:272942 136/340 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.